Lineage for d1i08b1 (1i08 B:1-90)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303511Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2303512Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 2303638Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)
  7. 2303663Species Escherichia coli [TaxId:562] [46620] (12 PDB entries)
  8. 2303693Domain d1i08b1: 1i08 B:1-90 [15771]
    Other proteins in same PDB: d1i08a2, d1i08b2, d1i08c2, d1i08d2
    complexed with mn; mutant

Details for d1i08b1

PDB Entry: 1i08 (more details), 2.2 Å

PDB Description: crystal structure analysis of the h30a mutant of manganese superoxide dismutase from e. coli
PDB Compounds: (B:) manganese superoxide dismutase

SCOPe Domain Sequences for d1i08b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i08b1 a.2.11.1 (B:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
sytlpslpyaydalephfdkqtmeihhtkahqtyvnnanaaleslpefanlpveelitkl
dqlpadkktvlrnnagghanhslfwkglkk

SCOPe Domain Coordinates for d1i08b1:

Click to download the PDB-style file with coordinates for d1i08b1.
(The format of our PDB-style files is described here.)

Timeline for d1i08b1: