Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.55: Ribosomal protein L22 [54842] (1 superfamily) beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation |
Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) some topological similarity to prokaryotic ribosomal protein L17 |
Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein) |
Protein Ribosomal protein L22 [54845] (5 species) |
Species Escherichia coli [TaxId:562] [160266] (29 PDB entries) Uniprot P61175 1-110 |
Domain d3df4s1: 3df4 S:1-110 [157702] Other proteins in same PDB: d3df401, d3df411, d3df431, d3df441, d3df4c1, d3df4c2, d3df4d1, d3df4e1, d3df4f1, d3df4g1, d3df4g2, d3df4h1, d3df4h2, d3df4i1, d3df4i2, d3df4j1, d3df4k1, d3df4l1, d3df4m1, d3df4n1, d3df4o1, d3df4p1, d3df4q1, d3df4r1, d3df4t1, d3df4u1, d3df4v1, d3df4w1, d3df4x1, d3df4y1, d3df4z1 protein/RNA complex; complexed with mg, zn protein/RNA complex; complexed with mg, zn |
PDB Entry: 3df4 (more details), 3.5 Å
SCOPe Domain Sequences for d3df4s1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3df4s1 d.55.1.1 (S:1-110) Ribosomal protein L22 {Escherichia coli [TaxId: 562]} metiakhrharssaqkvrlvadlirgkkvsqaldiltytnkkaavlvkkvlesaianaeh ndgadiddlkvtkifvdegpsmkrimprakgradrilkrtshitvvvsdr
Timeline for d3df4s1:
View in 3D Domains from other chains: (mouse over for more information) d3df401, d3df411, d3df431, d3df441, d3df4c1, d3df4c2, d3df4d1, d3df4e1, d3df4f1, d3df4g1, d3df4g2, d3df4h1, d3df4h2, d3df4i1, d3df4i2, d3df4j1, d3df4k1, d3df4l1, d3df4m1, d3df4n1, d3df4o1, d3df4p1, d3df4q1, d3df4r1, d3df4t1, d3df4u1, d3df4v1, d3df4w1, d3df4x1, d3df4y1, d3df4z1 |