Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) |
Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein) |
Protein Ribosomal protein L11, C-terminal domain [46908] (6 species) |
Species Escherichia coli [TaxId:562] [158349] (29 PDB entries) Uniprot P0A7J7 73-141 |
Domain d3df4i1: 3df4 I:73-141 [157691] Other proteins in same PDB: d3df401, d3df411, d3df431, d3df441, d3df4c1, d3df4c2, d3df4d1, d3df4e1, d3df4f1, d3df4g1, d3df4g2, d3df4h1, d3df4h2, d3df4i2, d3df4j1, d3df4k1, d3df4l1, d3df4m1, d3df4n1, d3df4o1, d3df4p1, d3df4q1, d3df4r1, d3df4s1, d3df4t1, d3df4u1, d3df4v1, d3df4w1, d3df4x1, d3df4y1, d3df4z1 protein/RNA complex; complexed with mg, zn protein/RNA complex; complexed with mg, zn |
PDB Entry: 3df4 (more details), 3.5 Å
SCOPe Domain Sequences for d3df4i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3df4i1 a.4.7.1 (I:73-141) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]} ppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgadieamtrsiegta rsmglvved
Timeline for d3df4i1:
View in 3D Domains from other chains: (mouse over for more information) d3df401, d3df411, d3df431, d3df441, d3df4c1, d3df4c2, d3df4d1, d3df4e1, d3df4f1, d3df4g1, d3df4g2, d3df4h1, d3df4h2, d3df4j1, d3df4k1, d3df4l1, d3df4m1, d3df4n1, d3df4o1, d3df4p1, d3df4q1, d3df4r1, d3df4s1, d3df4t1, d3df4u1, d3df4v1, d3df4w1, d3df4x1, d3df4y1, d3df4z1 |