Lineage for d3df4c2 (3df4 C:61-124)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799717Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 protein domains)
    barrel, closed; n=5, S=8
  6. 799829Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 799881Species Escherichia coli [TaxId:562] [159086] (27 PDB entries)
    Uniprot P60422 3-124
  8. 799891Domain d3df4c2: 3df4 C:61-124 [157683]
    Other proteins in same PDB: d3df401, d3df411, d3df431, d3df441, d3df4c1, d3df4d1, d3df4e1, d3df4f1, d3df4g1, d3df4g2, d3df4h1, d3df4h2, d3df4i1, d3df4i2, d3df4j1, d3df4k1, d3df4l1, d3df4m1, d3df4n1, d3df4o1, d3df4p1, d3df4q1, d3df4r1, d3df4s1, d3df4t1, d3df4u1, d3df4v1, d3df4w1, d3df4x1, d3df4y1, d3df4z1
    automatically matched to 2AW4 C:61-124
    complexed with mg, zn

Details for d3df4c2

PDB Entry: 3df4 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (C:) 50S ribosomal protein L2

SCOP Domain Sequences for d3df4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df4c2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd
aaik

SCOP Domain Coordinates for d3df4c2:

Click to download the PDB-style file with coordinates for d3df4c2.
(The format of our PDB-style files is described here.)

Timeline for d3df4c2: