SCOPe 2.07: Domain d1vewc1: 1vew C:1-90

Lineage for d1vewc1 (1vew C:1-90)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)

7. Species Escherichia coli [TaxId:562] [46620] (12 PDB entries)

8. Domain d1vewc1: 1vew C:1-90 [15768]
   Other proteins in same PDB: d1vewa2, d1vewb2, d1vewc2, d1vewd2
   complexed with mn, oh

Details for d1vewc1

PDB Entry: 1vew, 2.1 Å

PDB Description: manganese superoxide dismutase from escherichia coli

PDB Compounds: (C:) manganese superoxide dismutase

SCOPe Domain Sequences for d1vewc1:

Sequence; same for both SEQRES and ATOM records:

>d1vewc1 a.2.11.1 (C:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
dqlpadkktvlrnnagghanhslfwkglkk

Timeline for d1vewc1:

• d1vewc1 first appeared (with stable ids) in SCOP 1.55
  
• d1vewc1 appears in SCOPe 2.06
  
• d1vewc1 appears in the current release, SCOPe 2.08