SCOPe 2.06: Domain d3df3r1: 3df3 R:19-73

Lineage for d3df3r1 (3df3 R:19-73)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (2 species)

7. Species Escherichia coli [TaxId:562] [158351] (24 PDB entries)
   Uniprot P0A7T7 19-73

8. Domain d3df3r1: 3df3 R:19-73 [157674]
   Other proteins in same PDB: d3df3b1, d3df3c1, d3df3c2, d3df3d1, d3df3e1, d3df3e2, d3df3f1, d3df3g1, d3df3h1, d3df3i1, d3df3j1, d3df3k1, d3df3l1, d3df3m1, d3df3n1, d3df3o1, d3df3p1, d3df3q1, d3df3s1, d3df3t1, d3df3u1
   protein/RNA complex; complexed with hyg, mg
   protein/RNA complex; complexed with hyg, mg

Details for d3df3r1

PDB Entry: 3df3, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the second 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d3df3r1:

Sequence; same for both SEQRES and ATOM records:

>d3df3r1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]}
eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh

Timeline for d3df3r1:

• d3df3r1 first appeared in SCOP 1.75
  
• d3df3r1 appears in SCOPe 2.05
  
• d3df3r1 appears in SCOPe 2.07
  
• d3df3r1 appears in the current release, SCOPe 2.08