![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
![]() | Protein Mn superoxide dismutase (MnSOD) [46618] (9 species) |
![]() | Species Escherichia coli [TaxId:562] [46620] (12 PDB entries) |
![]() | Domain d1vewb1: 1vew B:1-90 [15767] Other proteins in same PDB: d1vewa2, d1vewb2, d1vewc2, d1vewd2 complexed with mn, oh |
PDB Entry: 1vew (more details), 2.1 Å
SCOPe Domain Sequences for d1vewb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vewb1 a.2.11.1 (B:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl dqlpadkktvlrnnagghanhslfwkglkk
Timeline for d1vewb1: