Lineage for d3df3f1 (3df3 F:1-100)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196631Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 2196632Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 2196633Protein Ribosomal protein S6 [54997] (4 species)
  7. 2196636Species Escherichia coli [TaxId:562] [160317] (24 PDB entries)
    Uniprot P02358 1-100
  8. 2196645Domain d3df3f1: 3df3 F:1-100 [157662]
    Other proteins in same PDB: d3df3b1, d3df3c1, d3df3c2, d3df3d1, d3df3e1, d3df3e2, d3df3g1, d3df3h1, d3df3i1, d3df3j1, d3df3k1, d3df3l1, d3df3m1, d3df3n1, d3df3o1, d3df3p1, d3df3q1, d3df3r1, d3df3s1, d3df3t1, d3df3u1
    protein/RNA complex; complexed with hyg, mg
    protein/RNA complex; complexed with hyg, mg

Details for d3df3f1

PDB Entry: 3df3 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the second 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d3df3f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df3f1 d.58.14.1 (F:1-100) Ribosomal protein S6 {Escherichia coli [TaxId: 562]}
mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
lmnveapqevidelettfrfndavirsmvmrtkhavteas

SCOPe Domain Coordinates for d3df3f1:

Click to download the PDB-style file with coordinates for d3df3f1.
(The format of our PDB-style files is described here.)

Timeline for d3df3f1: