SCOPe 2.03: Domain d3df3e1: 3df3 E:78-158

Lineage for d3df3e1 (3df3 E:78-158)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)

7. Species Escherichia coli [TaxId:562] [159906] (24 PDB entries)
   Uniprot P0A7W1 78-158

8. Domain d3df3e1: 3df3 E:78-158 [157660]
   Other proteins in same PDB: d3df3b1, d3df3c1, d3df3c2, d3df3d1, d3df3e2, d3df3f1, d3df3g1, d3df3h1, d3df3i1, d3df3j1, d3df3k1, d3df3l1, d3df3m1, d3df3n1, d3df3o1, d3df3p1, d3df3q1, d3df3r1, d3df3s1, d3df3t1, d3df3u1
   automatically matched to 2AVY E:78-158
   protein/RNA complex; complexed with hyg, mg

Details for d3df3e1

PDB Entry: 3df3, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the second 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d3df3e1:

Sequence; same for both SEQRES and ATOM records:

>d3df3e1 d.14.1.1 (E:78-158) Ribosomal protein S5, C-terminal domain {Escherichia coli [TaxId: 562]}
gtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvhnvlakaygstnpinvvr
atidglenmnspemvaakrgk

Timeline for d3df3e1:

• d3df3e1 first appeared in SCOP 1.75
  
• d3df3e1 appears in SCOPe 2.02
  
• d3df3e1 appears in SCOPe 2.04
  
• d3df3e1 appears in the current release, SCOPe 2.08