SCOPe 2.05: Domain d3df3c2: 3df3 C:106-206

Lineage for d3df3c2 (3df3 C:106-206)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
   alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143

4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family)
   automatically mapped to Pfam PF00189

5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)

6. Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)

7. Species Escherichia coli [TaxId:562] [160263] (24 PDB entries)
   Uniprot P0A7V3 106-206

8. Domain d3df3c2: 3df3 C:106-206 [157658]
   Other proteins in same PDB: d3df3b1, d3df3c1, d3df3d1, d3df3e1, d3df3e2, d3df3f1, d3df3g1, d3df3h1, d3df3i1, d3df3j1, d3df3k1, d3df3l1, d3df3m1, d3df3n1, d3df3o1, d3df3p1, d3df3q1, d3df3r1, d3df3s1, d3df3t1, d3df3u1
   protein/RNA complex; complexed with hyg, mg
   protein/RNA complex; complexed with hyg, mg

Details for d3df3c2

PDB Entry: 3df3, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the second 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d3df3c2:

Sequence; same for both SEQRES and ATOM records:

>d3df3c2 d.53.1.1 (C:106-206) Ribosomal protein S3 C-terminal domain {Escherichia coli [TaxId: 562]}
rkpeldaklvadsitsqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiarte
wyregrvplhtlradidyntseahttygvigvkvwifkgei

Timeline for d3df3c2:

• d3df3c2 first appeared in SCOP 1.75
  
• d3df3c2 appears in SCOPe 2.04
  
• d3df3c2 appears in SCOPe 2.06
  
• d3df3c2 appears in the current release, SCOPe 2.08