Lineage for d3df3c1 (3df3 C:1-105)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904630Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 1904679Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 1904680Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 1904696Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)
  7. 1904699Species Escherichia coli [TaxId:562] [160236] (24 PDB entries)
    Uniprot P0A7V3 1-105
  8. 1904708Domain d3df3c1: 3df3 C:1-105 [157657]
    Other proteins in same PDB: d3df3b1, d3df3c2, d3df3d1, d3df3e1, d3df3e2, d3df3f1, d3df3g1, d3df3h1, d3df3i1, d3df3j1, d3df3k1, d3df3l1, d3df3m1, d3df3n1, d3df3o1, d3df3p1, d3df3q1, d3df3r1, d3df3s1, d3df3t1, d3df3u1
    protein/RNA complex; complexed with hyg, mg
    protein/RNA complex; complexed with hyg, mg

Details for d3df3c1

PDB Entry: 3df3 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the second 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d3df3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df3c1 d.52.3.1 (C:1-105) Ribosomal protein S3 N-terminal domain {Escherichia coli [TaxId: 562]}
gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaev

SCOPe Domain Coordinates for d3df3c1:

Click to download the PDB-style file with coordinates for d3df3c1.
(The format of our PDB-style files is described here.)

Timeline for d3df3c1: