Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
Protein Ribosomal protein S3 N-terminal domain [54816] (4 species) |
Species Escherichia coli [TaxId:562] [160236] (24 PDB entries) Uniprot P0A7V3 1-105 |
Domain d3df3c1: 3df3 C:1-105 [157657] Other proteins in same PDB: d3df3b1, d3df3c2, d3df3d1, d3df3e1, d3df3e2, d3df3f1, d3df3g1, d3df3h1, d3df3i1, d3df3j1, d3df3k1, d3df3l1, d3df3m1, d3df3n1, d3df3o1, d3df3p1, d3df3q1, d3df3r1, d3df3s1, d3df3t1, d3df3u1 automatically matched to 2AVY C:1-105 complexed with hyg, mg |
PDB Entry: 3df3 (more details), 3.5 Å
SCOP Domain Sequences for d3df3c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3df3c1 d.52.3.1 (C:1-105) Ribosomal protein S3 N-terminal domain {Escherichia coli [TaxId: 562]} gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaev
Timeline for d3df3c1: