Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.21: Ribosomal protein L13 [52160] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) |
Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein) |
Protein Ribosomal protein L13 [52163] (5 species) synonym: 50S ribosomal protein L13p, HMAL13 |
Species Escherichia coli [TaxId:562] [159474] (29 PDB entries) Uniprot P02410 1-140 |
Domain d3df2j1: 3df2 J:1-140 [157639] Other proteins in same PDB: d3df201, d3df211, d3df231, d3df241, d3df2c1, d3df2c2, d3df2d1, d3df2e1, d3df2f1, d3df2g1, d3df2g2, d3df2h1, d3df2h2, d3df2i1, d3df2i2, d3df2k1, d3df2l1, d3df2m1, d3df2n1, d3df2o1, d3df2p1, d3df2q1, d3df2r1, d3df2s1, d3df2t1, d3df2u1, d3df2v1, d3df2w1, d3df2x1, d3df2y1, d3df2z1 automatically matched to 2AW4 J:1-140 protein/RNA complex; complexed with mg, zn |
PDB Entry: 3df2 (more details), 3.5 Å
SCOPe Domain Sequences for d3df2j1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3df2j1 c.21.1.1 (J:1-140) Ribosomal protein L13 {Escherichia coli [TaxId: 562]} mktftakpetvkrdwyvvdatgktlgrlatelarrlrgkhkaeytphvdtgdyiivlnad kvavtgnkrtdkvyyhhtghiggikqatfeemiarrpervieiavkgmlpkgplgramfr klkvyagnehnhaaqqpqvl
Timeline for d3df2j1:
View in 3D Domains from other chains: (mouse over for more information) d3df201, d3df211, d3df231, d3df241, d3df2c1, d3df2c2, d3df2d1, d3df2e1, d3df2f1, d3df2g1, d3df2g2, d3df2h1, d3df2h2, d3df2i1, d3df2i2, d3df2k1, d3df2l1, d3df2m1, d3df2n1, d3df2o1, d3df2p1, d3df2q1, d3df2r1, d3df2s1, d3df2t1, d3df2u1, d3df2v1, d3df2w1, d3df2x1, d3df2y1, d3df2z1 |