Lineage for d3df2h2 (3df2 H:1-58)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1036519Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 1036520Superfamily d.100.1: L9 N-domain-like [55658] (3 families) (S)
  5. 1036521Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
  6. 1036522Protein Ribosomal protein L9 N-domain [55660] (3 species)
  7. 1036534Species Escherichia coli [TaxId:562] [160581] (29 PDB entries)
    Uniprot P0A7R1 1-58
  8. 1036544Domain d3df2h2: 3df2 H:1-58 [157636]
    Other proteins in same PDB: d3df201, d3df211, d3df231, d3df241, d3df2c1, d3df2c2, d3df2d1, d3df2e1, d3df2f1, d3df2g1, d3df2g2, d3df2h1, d3df2i1, d3df2i2, d3df2j1, d3df2k1, d3df2l1, d3df2m1, d3df2n1, d3df2o1, d3df2p1, d3df2q1, d3df2r1, d3df2s1, d3df2t1, d3df2u1, d3df2v1, d3df2w1, d3df2x1, d3df2y1, d3df2z1
    automatically matched to 2AW4 H:1-58
    protein/RNA complex; complexed with mg, zn

Details for d3df2h2

PDB Entry: 3df2 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 50S subunit of the first 70S ribosome. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (H:) 50S ribosomal protein L9

SCOPe Domain Sequences for d3df2h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df2h2 d.100.1.1 (H:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]}
mqvilldkvanlgslgdqvnvkagyarnflvpqgkavpatkknieffearraeleakl

SCOPe Domain Coordinates for d3df2h2:

Click to download the PDB-style file with coordinates for d3df2h2.
(The format of our PDB-style files is described here.)

Timeline for d3df2h2: