SCOPe 2.06: Domain d3df1u1: 3df1 U:3-53

Lineage for d3df1u1 (3df1 U:3-53)

1. Root: SCOPe 2.06

2. Class j: Peptides [58231] (133 folds)

3. Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
   non-globular, mainly alpha-helical

4. Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family)

5. Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
   Pfam PF01165

6. Protein Ribosomal protein S21, RpsU [161310] (1 species)

7. Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
   Uniprot P68679 4-54

8. Domain d3df1u1: 3df1 U:3-53 [157623]
   Other proteins in same PDB: d3df1b1, d3df1c1, d3df1c2, d3df1d1, d3df1e1, d3df1e2, d3df1f1, d3df1g1, d3df1h1, d3df1i1, d3df1j1, d3df1k1, d3df1l1, d3df1m1, d3df1n1, d3df1o1, d3df1p1, d3df1q1, d3df1r1, d3df1s1, d3df1t1
   protein/RNA complex; complexed with hyg, mg
   protein/RNA complex; complexed with hyg, mg

Details for d3df1u1

PDB Entry: 3df1, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the first 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (U:) 30S ribosomal protein S21

SCOPe Domain Sequences for d3df1u1:

Sequence; same for both SEQRES and ATOM records:

>d3df1u1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

Timeline for d3df1u1:

• d3df1u1 first appeared in SCOP 1.75
  
• d3df1u1 appears in SCOPe 2.05
  
• d3df1u1 appears in SCOPe 2.07
  
• d3df1u1 appears in the current release, SCOPe 2.08