Lineage for d3df1q1 (3df1 Q:3-82)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1124965Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1125285Protein Ribosomal protein S17 [50304] (3 species)
  7. 1125288Species Escherichia coli [TaxId:562] [159088] (26 PDB entries)
    Uniprot P02373 3-82
  8. 1125295Domain d3df1q1: 3df1 Q:3-82 [157619]
    Other proteins in same PDB: d3df1b1, d3df1c1, d3df1c2, d3df1d1, d3df1e1, d3df1e2, d3df1f1, d3df1g1, d3df1h1, d3df1i1, d3df1j1, d3df1k1, d3df1l1, d3df1m1, d3df1n1, d3df1o1, d3df1p1, d3df1r1, d3df1s1, d3df1t1, d3df1u1
    automatically matched to 2AVY Q:3-82
    protein/RNA complex; complexed with hyg, mg

Details for d3df1q1

PDB Entry: 3df1 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with hygromycin B. This file contains the 30S subunit of the first 70S ribosome, with hygromycin B bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (Q:) 30S ribosomal protein S17

SCOPe Domain Sequences for d3df1q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df1q1 b.40.4.5 (Q:3-82) Ribosomal protein S17 {Escherichia coli [TaxId: 562]}
kirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveire
crplsktkswtlvrvvekav

SCOPe Domain Coordinates for d3df1q1:

Click to download the PDB-style file with coordinates for d3df1q1.
(The format of our PDB-style files is described here.)

Timeline for d3df1q1: