![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.27: Ribosomal protein S16 [54564] (1 superfamily) beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234 |
![]() | Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) ![]() |
![]() | Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein) |
![]() | Protein Ribosomal protein S16 [54567] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [160143] (26 PDB entries) Uniprot P0A7T3 1-82 |
![]() | Domain d3df1p1: 3df1 P:1-82 [157618] Other proteins in same PDB: d3df1b1, d3df1c1, d3df1c2, d3df1d1, d3df1e1, d3df1e2, d3df1f1, d3df1g1, d3df1h1, d3df1i1, d3df1j1, d3df1k1, d3df1l1, d3df1m1, d3df1n1, d3df1o1, d3df1q1, d3df1r1, d3df1s1, d3df1t1, d3df1u1 automatically matched to 2AVY P:1-82 protein/RNA complex; complexed with hyg, mg |
PDB Entry: 3df1 (more details), 3.5 Å
SCOPe Domain Sequences for d3df1p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3df1p1 d.27.1.1 (P:1-82) Ribosomal protein S16 {Escherichia coli [TaxId: 562]} mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw vgqgatisdrvaalikevnkaa
Timeline for d3df1p1: