![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
![]() | Protein 70S ribosome functional complex [58121] (9 species) |
![]() | Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
![]() | Domain d3df1h1: 3df1 H:2-128 [157610] Other proteins in same PDB: d3df1b1, d3df1c1, d3df1c2, d3df1d1, d3df1e1, d3df1e2, d3df1f1, d3df1g1, d3df1i1, d3df1j1, d3df1k1, d3df1l1, d3df1m1, d3df1n1, d3df1o1, d3df1p1, d3df1q1, d3df1r1, d3df1s1, d3df1t1, d3df1u1 automatically matched to d1p6gh_ protein/RNA complex; complexed with hyg, mg |
PDB Entry: 3df1 (more details), 3.5 Å
SCOPe Domain Sequences for d3df1h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3df1h1 i.1.1.1 (H:2-128) 70S ribosome functional complex {Escherichia coli [TaxId: 562]} mqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelelt lkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglg geiicyv
Timeline for d3df1h1: