SCOPe 2.06: Domain d3deub2: 3deu B:3-141

Lineage for d3deub2 (3deu B:3-141)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Transcriptional regulator SlyA [81688] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [158271] (3 PDB entries)
   Uniprot P40676 1-140

8. Domain d3deub2: 3deu B:3-141 [157601]
   Other proteins in same PDB: d3deua2, d3deub3
   automated match to d3deua1
   protein/DNA complex; complexed with sal

Details for d3deub2

PDB Entry: 3deu, 2.3 Å

PDB Description: crystal structure of transcription regulatory protein slya from salmonella typhimurium in complex with salicylate ligands

PDB Compounds: (B:) Transcriptional regulator slyA

SCOPe Domain Sequences for d3deub2:

Sequence, based on SEQRES records:

>d3deub2 a.4.5.28 (B:3-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]}
esplgsdlarlvriwralidhrlkpleltqthwvtlhnihqlppdqsqiqlakaigieqp
slvrtldqledkglisrqtcasdrrakrikltekaepliaemeevihktrgeilagisse
eiellikliaklehnimel

Sequence, based on observed residues (ATOM records):

>d3deub2 a.4.5.28 (B:3-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]}
esplgsdlarlvriwralidhrlkpleltqthwvtlhnihqlppdqsqiqlakaigieqp
slvrtldqledkglisrrikltekaepliaemeevihktrgeilagisseeielliklia
klehnimel

Timeline for d3deub2:

• d3deub2 first appeared in SCOP 1.75, called d3deub1
  
• d3deub2 was called d3deub_ in SCOPe 2.05
  
• d3deub2 appears in SCOPe 2.07
  
• d3deub2 appears in the current release, SCOPe 2.08