Lineage for d3deub2 (3deu B:3-141)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693716Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2693803Protein Transcriptional regulator SlyA [81688] (2 species)
  7. 2693807Species Salmonella typhimurium [TaxId:90371] [158271] (3 PDB entries)
    Uniprot P40676 1-140
  8. 2693809Domain d3deub2: 3deu B:3-141 [157601]
    Other proteins in same PDB: d3deua2, d3deub3
    automated match to d3deua1
    protein/DNA complex; complexed with sal

Details for d3deub2

PDB Entry: 3deu (more details), 2.3 Å

PDB Description: crystal structure of transcription regulatory protein slya from salmonella typhimurium in complex with salicylate ligands
PDB Compounds: (B:) Transcriptional regulator slyA

SCOPe Domain Sequences for d3deub2:

Sequence, based on SEQRES records: (download)

>d3deub2 a.4.5.28 (B:3-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]}
esplgsdlarlvriwralidhrlkpleltqthwvtlhnihqlppdqsqiqlakaigieqp
slvrtldqledkglisrqtcasdrrakrikltekaepliaemeevihktrgeilagisse
eiellikliaklehnimel

Sequence, based on observed residues (ATOM records): (download)

>d3deub2 a.4.5.28 (B:3-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]}
esplgsdlarlvriwralidhrlkpleltqthwvtlhnihqlppdqsqiqlakaigieqp
slvrtldqledkglisrrikltekaepliaemeevihktrgeilagisseeielliklia
klehnimel

SCOPe Domain Coordinates for d3deub2:

Click to download the PDB-style file with coordinates for d3deub2.
(The format of our PDB-style files is described here.)

Timeline for d3deub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3deub3