SCOPe 2.01: Domain d1i0ha1: 1i0h A:1-90

Lineage for d1i0ha1 (1i0h A:1-90)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family)

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [46618] (7 species)

7. Species Escherichia coli [TaxId:562] [46620] (11 PDB entries)

8. Domain d1i0ha1: 1i0h A:1-90 [15760]
   Other proteins in same PDB: d1i0ha2, d1i0hb2
   complexed with mn; mutant

Details for d1i0ha1

PDB Entry: 1i0h, 1.35 Å

PDB Description: crystal structure of the e. coli manganese superoxide dismutase mutant y174f at 1.35 angstroms resolution.

PDB Compounds: (A:) manganese superoxide dismutase y174f mutant

SCOPe Domain Sequences for d1i0ha1:

Sequence; same for both SEQRES and ATOM records:

>d1i0ha1 a.2.11.1 (A:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
dqlpadkktvlrnnagghanhslfwkglkk

Timeline for d1i0ha1:

• d1i0ha1 first appeared (with stable ids) in SCOP 1.55
  
• d1i0ha1 appears in SCOP 1.75
  
• d1i0ha1 appears in SCOPe 2.02
  
• d1i0ha1 appears in the current release, SCOPe 2.08