Class a: All alpha proteins [46456] (284 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) |
Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins) |
Protein Mn superoxide dismutase (MnSOD) [46618] (7 species) |
Species Escherichia coli [TaxId:562] [46620] (11 PDB entries) |
Domain d1i0ha1: 1i0h A:1-90 [15760] Other proteins in same PDB: d1i0ha2, d1i0hb2 complexed with mn; mutant |
PDB Entry: 1i0h (more details), 1.35 Å
SCOPe Domain Sequences for d1i0ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i0ha1 a.2.11.1 (A:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl dqlpadkktvlrnnagghanhslfwkglkk
Timeline for d1i0ha1: