Lineage for d3detd2 (3det D:107-210)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786045Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)
  7. 786046Species Escherichia coli [TaxId:562] [158872] (3 PDB entries)
  8. 786051Domain d3detd2: 3det D:107-210 [157597]
    Other proteins in same PDB: d3detd1, d3detf1
    automatically matched to d1dqdl2
    mutant

Details for d3detd2

PDB Entry: 3det (more details), 2.8 Å

PDB Description: structure of the e148a, y445a doubly ungated mutant of e.coli clc_ec1, cl-/h+ antiporter
PDB Compounds: (D:) Fab fragment, light chain

SCOP Domain Sequences for d3detd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3detd2 b.1.1.2 (D:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Escherichia coli [TaxId: 562]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d3detd2:

Click to download the PDB-style file with coordinates for d3detd2.
(The format of our PDB-style files is described here.)

Timeline for d3detd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3detd1