SCOP 1.75: Domain d3detd2: 3det D:107-210

Lineage for d3detd2 (3det D:107-210)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)

7. Species Escherichia coli [TaxId:562] [158872] (3 PDB entries)

8. Domain d3detd2: 3det D:107-210 [157597]
   Other proteins in same PDB: d3detd1, d3detf1
   automatically matched to d1dqdl2
   mutant

Details for d3detd2

PDB Entry: 3det, 2.8 Å

PDB Description: structure of the e148a, y445a doubly ungated mutant of e.coli clc_ec1, cl-/h+ antiporter

PDB Compounds: (D:) Fab fragment, light chain

SCOP Domain Sequences for d3detd2:

Sequence; same for both SEQRES and ATOM records:

>d3detd2 b.1.1.2 (D:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Escherichia coli [TaxId: 562]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d3detd2:

• d3detd2 is new in SCOP 1.75
  
• d3detd2 appears in SCOPe 2.01
  
• d3detd2 appears in the current release, SCOPe 2.08