Lineage for d3detd1 (3det D:1-105)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 930396Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 930469Species Escherichia coli [TaxId:562] [158860] (3 PDB entries)
  8. 930474Domain d3detd1: 3det D:1-105 [157596]
    Other proteins in same PDB: d3detd2, d3detf2
    automatically matched to d1dqdl1
    mutant

Details for d3detd1

PDB Entry: 3det (more details), 2.8 Å

PDB Description: structure of the e148a, y445a doubly ungated mutant of e.coli clc_ec1, cl-/h+ antiporter
PDB Compounds: (D:) Fab fragment, light chain

SCOPe Domain Sequences for d3detd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3detd1 b.1.1.1 (D:1-105) Immunoglobulin light chain kappa variable domain, VL-kappa {Escherichia coli [TaxId: 562]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtklei

SCOPe Domain Coordinates for d3detd1:

Click to download the PDB-style file with coordinates for d3detd1.
(The format of our PDB-style files is described here.)

Timeline for d3detd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3detd2