Lineage for d3depa2 (3dep A:130-218)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1685730Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1685731Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1685732Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
  6. 1685821Protein automated matches [190101] (6 species)
    not a true protein
  7. 1685867Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [161332] (2 PDB entries)
  8. 1685869Domain d3depa2: 3dep A:130-218 [157595]
    Other proteins in same PDB: d3depa1
    automatically matched to d1n0qb_
    complexed with cl

Details for d3depa2

PDB Entry: 3dep (more details), 2.7 Å

PDB Description: Structural basis for specific substrate recognition by the chloroplast signal recognition particle protein cpSRP43
PDB Compounds: (A:) Signal recognition particle 43 kDa protein

SCOPe Domain Sequences for d3depa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3depa2 d.211.1.1 (A:130-218) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tpwwtaarkadeqalsqlledrdvdavdengrtallfvaglgsdkcvrllaeagadldhr
dmrggltalhmaagyvrpevvealvelga

SCOPe Domain Coordinates for d3depa2:

Click to download the PDB-style file with coordinates for d3depa2.
(The format of our PDB-style files is described here.)

Timeline for d3depa2: