Lineage for d3depa1 (3dep A:85-128)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1785119Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 1785158Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 1785195Protein CpSRP43 [141216] (1 species)
    Signal recognition particle 43 kDa protein, chloroplast precursor (CAO)
  7. 1785196Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141217] (6 PDB entries)
    Uniprot O22265 265-319! Uniprot O22265 320-373! Uniprot O22265 84-128
  8. 1785198Domain d3depa1: 3dep A:85-128 [157594]
    Other proteins in same PDB: d3depa2
    automatically matched to d1x32a1
    complexed with cl

Details for d3depa1

PDB Entry: 3dep (more details), 2.7 Å

PDB Description: Structural basis for specific substrate recognition by the chloroplast signal recognition particle protein cpSRP43
PDB Compounds: (A:) Signal recognition particle 43 kDa protein

SCOPe Domain Sequences for d3depa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3depa1 b.34.13.2 (A:85-128) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
evnkiigsrtagegameyliewkdghspswvpssyiaadvvsey

SCOPe Domain Coordinates for d3depa1:

Click to download the PDB-style file with coordinates for d3depa1.
(The format of our PDB-style files is described here.)

Timeline for d3depa1: