SCOP 1.75: Domain d3depa1: 3dep A:85-128

Lineage for d3depa1 (3dep A:85-128)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (3 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (7 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein CpSRP43 [141216] (1 species)
   Signal recognition particle 43 kDa protein, chloroplast precursor (CAO)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141217] (6 PDB entries)
   Uniprot O22265 265-319! Uniprot O22265 320-373! Uniprot O22265 84-128

8. Domain d3depa1: 3dep A:85-128 [157594]
   Other proteins in same PDB: d3depa2
   automatically matched to d1x32a1
   complexed with cl

Details for d3depa1

PDB Entry: 3dep, 2.7 Å

PDB Description: Structural basis for specific substrate recognition by the chloroplast signal recognition particle protein cpSRP43

PDB Compounds: (A:) Signal recognition particle 43 kDa protein

SCOP Domain Sequences for d3depa1:

Sequence; same for both SEQRES and ATOM records:

>d3depa1 b.34.13.2 (A:85-128) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
evnkiigsrtagegameyliewkdghspswvpssyiaadvvsey

Timeline for d3depa1:

• d3depa1 is new in SCOP 1.75
  
• d3depa1 appears in SCOPe 2.01
  
• d3depa1 appears in the current release, SCOPe 2.08