SCOPe 2.04: Domain d3deoa2: 3deo A:130-218

Lineage for d3deoa2 (3deo A:130-218)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein automated matches [190101] (6 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [161332] (2 PDB entries)

8. Domain d3deoa2: 3deo A:130-218 [157593]
   Other proteins in same PDB: d3deoa1
   automatically matched to d1n0qb_
   complexed with mg

Details for d3deoa2

PDB Entry: 3deo, 1.5 Å

PDB Description: Structural basis for specific substrate recognition by the chloroplast signal recognition particle protein cpSRP43

PDB Compounds: (A:) Signal recognition particle 43 kDa protein

SCOPe Domain Sequences for d3deoa2:

Sequence; same for both SEQRES and ATOM records:

>d3deoa2 d.211.1.1 (A:130-218) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tpwwtaarkadeqalsqlledrdvdavdengrtallfvaglgsdkcvrllaeagadldhr
dmrggltalhmaagyvrpevvealvelga

Timeline for d3deoa2:

• d3deoa2 first appeared in SCOP 1.75
  
• d3deoa2 appears in SCOPe 2.03
  
• d3deoa2 appears in SCOPe 2.05
  
• d3deoa2 appears in the current release, SCOPe 2.08