Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (18 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein automated matches [190101] (6 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [161332] (2 PDB entries) |
Domain d3deoa2: 3deo A:130-218 [157593] Other proteins in same PDB: d3deoa1 automatically matched to d1n0qb_ complexed with mg |
PDB Entry: 3deo (more details), 1.5 Å
SCOPe Domain Sequences for d3deoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3deoa2 d.211.1.1 (A:130-218) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} tpwwtaarkadeqalsqlledrdvdavdengrtallfvaglgsdkcvrllaeagadldhr dmrggltalhmaagyvrpevvealvelga
Timeline for d3deoa2: