Lineage for d3dejc_ (3dej C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2100990Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 2100991Superfamily c.17.1: Caspase-like [52129] (3 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 2100992Family c.17.1.1: Caspase catalytic domain [52130] (8 protein domains)
  6. 2101112Protein automated matches [190398] (2 species)
    not a true protein
  7. 2101118Species Human (Homo sapiens) [TaxId:9606] [187267] (13 PDB entries)
  8. 2101138Domain d3dejc_: 3dej C: [157586]
    automated match to d1nmqa_
    complexed with rxc

Details for d3dejc_

PDB Entry: 3dej (more details), 2.6 Å

PDB Description: crystal structures of caspase-3 with bound isoquinoline-1,3,4-trione derivative inhibitors
PDB Compounds: (C:) Caspase-3

SCOPe Domain Sequences for d3dejc_:

Sequence, based on SEQRES records: (download)

>d3dejc_ c.17.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dnsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnkndltr
eeivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrcrsltg
kpklfiiqacrgteldcgietdsgvdddmachkipvdadflyaystapgyyswrnskdgs
wfiqslcamlkqyadklefmhiltrvnrkvatefesfsfdatfhakkqipcivsmltkel
yfyh

Sequence, based on observed residues (ATOM records): (download)

>d3dejc_ c.17.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dnsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnkndltr
eeivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrcrsltg
kpklfiiqacrgteldcgietkipvdadflyaystapgyyswrnskdgswfiqslcamlk
qyadklefmhiltrvnrkvatefesfsfdatfhakkqipcivsmltkelyfyh

SCOPe Domain Coordinates for d3dejc_:

Click to download the PDB-style file with coordinates for d3dejc_.
(The format of our PDB-style files is described here.)

Timeline for d3dejc_: