SCOPe 2.08: Domain d3degh2: 3deg H:1-72

Lineage for d3degh2 (3deg H:1-72)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
   beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123

4. Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family)

5. Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
   Pfam PF03946

6. Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)

7. Species Escherichia coli [TaxId:562] [160201] (29 PDB entries)
   Uniprot P0A7J7 1-72

8. Domain d3degh2: 3deg H:1-72 [157575]
   Other proteins in same PDB: d3degd1, d3degh1
   automatically matched to 2AW4 I:1-72
   protein/RNA complex

Details for d3degh2

PDB Entry: 3deg, 10.9 Å

PDB Description: complex of elongating escherichia coli 70s ribosome and ef4(lepa)- gmppnp

PDB Compounds: (H:) 50S ribosomal protein L11

SCOPe Domain Sequences for d3degh2:

Sequence; same for both SEQRES and ATOM records:

>d3degh2 d.47.1.1 (H:1-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]}
akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv
yadrsftfvtkt

Timeline for d3degh2:

• d3degh2 first appeared in SCOP 1.75
  
• d3degh2 appears in SCOPe 2.07