| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) ![]() |
| Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein) |
| Protein Ribosomal protein L11, C-terminal domain [46908] (6 species) |
| Species Escherichia coli [TaxId:562] [158349] (29 PDB entries) Uniprot P0A7J7 73-141 |
| Domain d3degh1: 3deg H:73-141 [157574] Other proteins in same PDB: d3degd1, d3degh2 automatically matched to 2AW4 I:73-141 protein/RNA complex |
PDB Entry: 3deg (more details), 10.9 Å
SCOPe Domain Sequences for d3degh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3degh1 a.4.7.1 (H:73-141) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]}
ppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgadieamtrsiegta
rsmglvved
Timeline for d3degh1: