SCOP 1.75: Domain d3ddqd2: 3ddq D:309-432

Lineage for d3ddqd2 (3ddq D:309-432)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (8 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47958] (25 PDB entries)

8. Domain d3ddqd2: 3ddq D:309-432 [157562]
   automatically matched to d1vina2
   complexed with rrc, sgm

Details for d3ddqd2

PDB Entry: 3ddq, 1.8 Å

PDB Description: Structure of phosphorylated Thr160 CDK2/cyclin A in complex with the inhibitor roscovitine

PDB Compounds: (D:) Cyclin-A2

SCOP Domain Sequences for d3ddqd2:

Sequence; same for both SEQRES and ATOM records:

>d3ddqd2 a.74.1.1 (D:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
ptinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvt
gqswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhgvsllnppe
tlnv

Timeline for d3ddqd2:

• d3ddqd2 is new in SCOP 1.75
  
• d3ddqd2 appears in SCOPe 2.01
  
• d3ddqd2 appears in the current release, SCOPe 2.08