![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (9 proteins) |
![]() | Protein Cyclin A [47956] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [47958] (11 PDB entries) |
![]() | Domain d3ddqb2: 3ddq B:310-432 [157560] Other proteins in same PDB: d3ddqa1, d3ddqa2, d3ddqc1, d3ddqc2, d3ddqd3 automated match to d4eojb2 complexed with rrc, sgm |
PDB Entry: 3ddq (more details), 1.8 Å
SCOPe Domain Sequences for d3ddqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ddqb2 a.74.1.1 (B:310-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} tinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvtg qswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhgvsllnppet lnv
Timeline for d3ddqb2: