SCOPe 2.08: Domain d3ddja2: 3ddj A:1-135

Lineage for d3ddja2 (3ddj A:1-135)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein Uncharacterized protein SSO3205 [160170] (1 species)
   duplication: comprises four CBS repeats

7. Species Sulfolobus solfataricus [TaxId:2287] [160171] (1 PDB entry)
   Uniprot Q97U20 1-135! Uniprot Q97U20 136-276

8. Domain d3ddja2: 3ddj A:1-135 [157554]
   Other proteins in same PDB: d3ddja3
   complexed with amp, peg

Details for d3ddja2

PDB Entry: 3ddj, 1.8 Å

PDB Description: crystal structure of a cbs domain-containing protein in complex with amp (sso3205) from sulfolobus solfataricus at 1.80 a resolution

PDB Compounds: (A:) CBS domain-containing protein

SCOPe Domain Sequences for d3ddja2:

Sequence, based on SEQRES records:

>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]}
mnietlmiknppilskedrlgsafkkineggigriivanekiegllttrdllstvesyck
dscsqgdlyhisttpiidymtpnpvtvyntsdeftainimvtrnfgslpvvdindkpvgi
vtereflllykdlde

Sequence, based on observed residues (ATOM records):

>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]}
mnietlmiknppilskedrlgsafkkineggigriivanekiegllttrdllstvesycc
sqgdlyhisttpiidymtpnpvtvyntsdeftainimvtrnfgslpvvdindkpvgivte
reflllykdlde

Timeline for d3ddja2:

• d3ddja2 first appeared in SCOP 1.75
  
• d3ddja2 appears in SCOPe 2.07