Lineage for d3ddja1 (3ddj A:136-276)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943253Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2943254Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2943255Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2943398Protein Uncharacterized protein SSO3205 [160170] (1 species)
    duplication: comprises four CBS repeats
  7. 2943399Species Sulfolobus solfataricus [TaxId:2287] [160171] (1 PDB entry)
    Uniprot Q97U20 1-135! Uniprot Q97U20 136-276
  8. 2943400Domain d3ddja1: 3ddj A:136-276 [157553]
    Other proteins in same PDB: d3ddja3
    complexed with amp, peg

Details for d3ddja1

PDB Entry: 3ddj (more details), 1.8 Å

PDB Description: crystal structure of a cbs domain-containing protein in complex with amp (sso3205) from sulfolobus solfataricus at 1.80 a resolution
PDB Compounds: (A:) CBS domain-containing protein

SCOPe Domain Sequences for d3ddja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]}
ifpvkvfmstkvqtiykevrldqavklmlrrgfrrlpvidddnkvvgivtvvnaikqlak
avdkldpdyfygkvvkdvmvtnlvtidelasvnraaaemivkrigsllilnkdntirgii
terdllialhhilvmekfkek

SCOPe Domain Coordinates for d3ddja1:

Click to download the PDB-style file with coordinates for d3ddja1.
(The format of our PDB-style files is described here.)

Timeline for d3ddja1: