Lineage for d3ddga3 (3ddg A:31-411)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1833668Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 1833746Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 1833747Family c.6.2.1: alpha-mannosidase [88714] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
  6. 1833748Protein Golgi alpha-mannosidase II [88715] (1 species)
  7. 1833749Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88716] (57 PDB entries)
    Uniprot Q24451 94-1107
  8. 1833788Domain d3ddga3: 3ddg A:31-411 [157552]
    Other proteins in same PDB: d3ddga1, d3ddga2
    automated match to d1qwna3
    complexed with gb7, mrd, nag, po4, zn

Details for d3ddga3

PDB Entry: 3ddg (more details), 1.74 Å

PDB Description: golgi mannosidase ii complex with (3r,4r,5r)-3,4-dihydroxy-5-({[(1r)- 2-hydroxy-1 phenylethyl]amino}methyl) methylpyrrolidin-2-one
PDB Compounds: (A:) Alpha-mannosidase 2

SCOPe Domain Sequences for d3ddga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ddga3 c.6.2.1 (A:31-411) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
cqdvvqdvpnvdvqmlelydrmsfkdidggvwkqgwnikydplkynahhklkvfvvphsh
ndpgwiqtfeeyyqhdtkhilsnalrhlhdnpemkfiwaeisyfarfyhdlgenkklqmk
sivkngqlefvtggwvmpdeanshwrnvllqltegqtwlkqfmnvtptaswaidpfghsp
tmpyilqksgfknmliqrthysvkkelaqqrqleflwrqiwdnkgdtalfthmmpfysyd
iphtcgpdpkvccqfdfkrmgsfglscpwkvpprtisdqnvaarsdllvdqwkkkaelyr
tnvlliplgddfrfkqntewdvqrvnyerlfehinsqahfnvqaqfgtlqeyfdavhqae
ragqaefptlsgdfftyadrs

SCOPe Domain Coordinates for d3ddga3:

Click to download the PDB-style file with coordinates for d3ddga3.
(The format of our PDB-style files is described here.)

Timeline for d3ddga3: