SCOPe 2.07: Domain d3ddfa1: 3ddf A:412-522

Lineage for d3ddfa1 (3ddf A:412-522)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (4 families)

5. Family a.8.3.1: alpha-mannosidase, domain 2 [88693] (2 proteins)
   family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family

6. Protein Golgi alpha-mannosidase II [88694] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88695] (57 PDB entries)
   Uniprot Q24451 94-1107

8. Domain d3ddfa1: 3ddf A:412-522 [157547]
   Other proteins in same PDB: d3ddfa2, d3ddfa3
   automated match to d1qwna1
   complexed with gb6, mpd, mrd, nag, zn

Details for d3ddfa1

PDB Entry: 3ddf, 1.2 Å

PDB Description: golgi mannosidase ii complex with (3r,4r,5r)-3,4-dihydroxy-5-({[(1r)- 2-hydroxy-1 phenylethyl]amino}methyl) pyrrolidin-2-one

PDB Compounds: (A:) Alpha-mannosidase 2

SCOPe Domain Sequences for d3ddfa1:

Sequence; same for both SEQRES and ATOM records:

>d3ddfa1 a.8.3.1 (A:412-522) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhh
dgitgtakthvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfs

Timeline for d3ddfa1:

• d3ddfa1 first appeared in SCOP 1.75
  
• d3ddfa1 appears in SCOPe 2.06
  
• d3ddfa1 appears in the current release, SCOPe 2.08