SCOP 1.75: Domain d3dcxb1: 3dcx B:12-124

Lineage for d3dcxb1 (3dcx B:12-124)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (13 families)

5. Family b.55.1.13: BPHL domain [159216] (2 proteins)
   Pfam PF08000; DUF1696, bacterial proteins with PH-like domain

6. Protein Uncharacterized protein Shew0819 [159219] (1 species)
   homopentameric ring assembly through the pairing of the beta-barrel edge strands

7. Species Shewanella loihica [TaxId:359303] [159220] (1 PDB entry)
   Uniprot A3QB43 9-124

8. Domain d3dcxb1: 3dcx B:12-124 [157542]
   automatically matched to 3DCX A:9-124
   complexed with cl, mpd

Details for d3dcxb1

PDB Entry: 3dcx, 2 Å

PDB Description: crystal structure of a duf1696 family protein with a pleckstrin- homology domain (shew_0819) from shewanella loihica pv-4 at 2.00 a resolution

PDB Compounds: (B:) Protein of Unknown Function (DUF1696) with Pleckstrin-homology Domains

SCOP Domain Sequences for d3dcxb1:

Sequence; same for both SEQRES and ATOM records:

>d3dcxb1 b.55.1.13 (B:12-124) Uncharacterized protein Shew0819 {Shewanella loihica [TaxId: 359303]}
aevnldelaqelgpimgdneqlalayrvirdmfvftnkrlilidkqgvtgkkvsyhsvpy
kaithfevetagtfdmdaelklwisgqkdplvkelkkgtdvvgiqktianfsl

Timeline for d3dcxb1:

• d3dcxb1 is new in SCOP 1.75
  
• d3dcxb1 is called d3dcxb_ in SCOPe 2.01
  
• d3dcxb1 appears in the current release, SCOPe 2.08, called d3dcxb_