| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
| Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
| Protein automated matches [190059] (14 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries) |
| Domain d3dcua_: 3dcu A: [157539] automated match to d1osha_ protein/DNA complex; complexed with o62 |
PDB Entry: 3dcu (more details), 2.95 Å
SCOPe Domain Sequences for d3dcua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dcua_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftk
klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyit
pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
penpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq
Timeline for d3dcua_: