Lineage for d3dcgb1 (3dcg B:17-112)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859355Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 859356Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 859357Family d.42.1.1: BTB/POZ domain [54696] (5 proteins)
  6. 859396Protein Elongin C [54699] (2 species)
  7. 859399Species Human (Homo sapiens) [TaxId:9606] [54700] (8 PDB entries)
  8. 859405Domain d3dcgb1: 3dcg B:17-112 [157536]
    Other proteins in same PDB: d3dcga1
    automatically matched to d1lm8c_

Details for d3dcgb1

PDB Entry: 3dcg (more details), 2.4 Å

PDB Description: Crystal Structure of the HIV Vif BC-box in Complex with Human ElonginB and ElonginC
PDB Compounds: (B:) Transcription elongation factor B polypeptide 1

SCOP Domain Sequences for d3dcgb1:

Sequence, based on SEQRES records: (download)

>d3dcgb1 d.42.1.1 (B:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d3dcgb1 d.42.1.1 (B:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamltnevnfreipshvlskvcmyftykvrytns
eipefpiapeialellmaanfldc

SCOP Domain Coordinates for d3dcgb1:

Click to download the PDB-style file with coordinates for d3dcgb1.
(The format of our PDB-style files is described here.)

Timeline for d3dcgb1: