Lineage for d3dcga_ (3dcg A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. Protein Elongin B [54246] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [54247] (51 PDB entries)
  8. Domain d3dcga_: 3dcg A: [157535]
    Other proteins in same PDB: d3dcgb_, d3dcgd_
    automated match to d1lm8b_
    protein/RNA complex

Details for d3dcga_

PDB Entry: 3dcg (more details), 2.4 Å

PDB Description: Crystal Structure of the HIV Vif BC-box in Complex with Human ElonginB and ElonginC
PDB Compounds: (A:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d3dcga_:

Sequence, based on SEQRES records: (download)

>d3dcga_ d.15.1.1 (A:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelp

Sequence, based on observed residues (ATOM records): (download)

>d3dcga_ d.15.1.1 (A:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafradtfealciepfssppelp

SCOPe Domain Coordinates for d3dcga_ are not available.

Timeline for d3dcga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3dcgb_, d3dcgc_, d3dcgd_