SCOP 1.75: Domain d3dc7c1: 3dc7 C:18-224

Lineage for d3dc7c1 (3dc7 C:18-224)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (9 families)

5. Family c.23.10.9: BT2961-like [159485] (2 proteins)
   PfamB PB005894;homotrimeric assembly

6. Protein Uncharacterized protein Lp3323 [159488] (1 species)

7. Species Lactobacillus plantarum [TaxId:1590] [159489] (1 PDB entry)
   Uniprot Q88SR8 18-224

8. Domain d3dc7c1: 3dc7 C:18-224 [157534]
   automatically matched to 3DC7 A:18-224
   complexed with mg, na, so4

Details for d3dc7c1

PDB Entry: 3dc7, 2.12 Å

PDB Description: crystal structure of the protein q88sr8 from lactobacillus plantarum. northeast structural genomics consortium target lpr109.

PDB Compounds: (C:) Putative uncharacterized protein lp_3323

SCOP Domain Sequences for d3dc7c1:

Sequence; same for both SEQRES and ATOM records:

>d3dc7c1 c.23.10.9 (C:18-224) Uncharacterized protein Lp3323 {Lactobacillus plantarum [TaxId: 1590]}
hvsfkrpawlgdsitannglatvhyhdilaadwdversdnlgisgstigsrydamavryq
aipedadfiavfggvndygrdqplgqygdcdmttfygalmmlltglqtnwptvpklfisa
ihigsdfggsfsavtnglgyrqsdyeaaiaqmtadygvphlslyrdagmtfaipaqaaiy
svdtlhpnnaghrviarklqsfldshf

Timeline for d3dc7c1:

• d3dc7c1 is new in SCOP 1.75
  
• d3dc7c1 is called d3dc7c_ in SCOPe 2.01
  
• d3dc7c1 appears in the current release, SCOPe 2.08, called d3dc7c2