Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.10: SGNH hydrolase [52266] (10 families) |
Family c.23.10.9: BT2961-like [159485] (3 proteins) PfamB PB005894;homotrimeric assembly |
Protein automated matches [190945] (1 species) not a true protein |
Species Lactobacillus plantarum [TaxId:1590] [188515] (1 PDB entry) |
Domain d3dc7b_: 3dc7 B: [157533] Other proteins in same PDB: d3dc7a1 automated match to d3dc7a1 complexed with mg, na, so4 |
PDB Entry: 3dc7 (more details), 2.12 Å
SCOPe Domain Sequences for d3dc7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dc7b_ c.23.10.9 (B:) automated matches {Lactobacillus plantarum [TaxId: 1590]} hvsfkrpawlgdsitannglatvhyhdilaadwdversdnlgisgstigsrydamavryq aipedadfiavfggvndygrdqplgqygdcdmttfygalmmlltglqtnwptvpklfisa ihigsdfggsfsavtnglgyrqsdyeaaiaqmtadygvphlslyrdagmtfaipaqaaiy svdtlhpnnaghrviarklqsfldshfle
Timeline for d3dc7b_: