SCOPe 2.08: Domain d3dc7b2: 3dc7 B:18-224

Lineage for d3dc7b2 (3dc7 B:18-224)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families)

5. Family c.23.10.9: BT2961-like [159485] (3 proteins)
   PfamB PB005894;homotrimeric assembly

6. Protein automated matches [190945] (1 species)
   not a true protein

7. Species Lactobacillus plantarum [TaxId:1590] [188515] (1 PDB entry)

8. Domain d3dc7b2: 3dc7 B:18-224 [157533]
   Other proteins in same PDB: d3dc7a1, d3dc7a2, d3dc7b3, d3dc7c3
   automated match to d3dc7a1
   complexed with mg, na, so4

Details for d3dc7b2

PDB Entry: 3dc7, 2.12 Å

PDB Description: crystal structure of the protein q88sr8 from lactobacillus plantarum. northeast structural genomics consortium target lpr109.

PDB Compounds: (B:) Putative uncharacterized protein lp_3323

SCOPe Domain Sequences for d3dc7b2:

Sequence; same for both SEQRES and ATOM records:

>d3dc7b2 c.23.10.9 (B:18-224) automated matches {Lactobacillus plantarum [TaxId: 1590]}
hvsfkrpawlgdsitannglatvhyhdilaadwdversdnlgisgstigsrydamavryq
aipedadfiavfggvndygrdqplgqygdcdmttfygalmmlltglqtnwptvpklfisa
ihigsdfggsfsavtnglgyrqsdyeaaiaqmtadygvphlslyrdagmtfaipaqaaiy
svdtlhpnnaghrviarklqsfldshf

Timeline for d3dc7b2:

• d3dc7b2 first appeared in SCOP 1.75, called d3dc7b1
  
• d3dc7b2 appears in SCOPe 2.07