| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.10: SGNH hydrolase [52266] (10 families) ![]() |
| Family c.23.10.9: BT2961-like [159485] (3 proteins) PfamB PB005894;homotrimeric assembly |
| Protein Uncharacterized protein Lp3323 [159488] (1 species) |
| Species Lactobacillus plantarum [TaxId:1590] [159489] (1 PDB entry) Uniprot Q88SR8 18-224 |
| Domain d3dc7a1: 3dc7 A:18-224 [157532] Other proteins in same PDB: d3dc7a2, d3dc7b2, d3dc7b3, d3dc7c2, d3dc7c3 complexed with mg, na, so4 |
PDB Entry: 3dc7 (more details), 2.12 Å
SCOPe Domain Sequences for d3dc7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dc7a1 c.23.10.9 (A:18-224) Uncharacterized protein Lp3323 {Lactobacillus plantarum [TaxId: 1590]}
hvsfkrpawlgdsitannglatvhyhdilaadwdversdnlgisgstigsrydamavryq
aipedadfiavfggvndygrdqplgqygdcdmttfygalmmlltglqtnwptvpklfisa
ihigsdfggsfsavtnglgyrqsdyeaaiaqmtadygvphlslyrdagmtfaipaqaaiy
svdtlhpnnaghrviarklqsfldshf
Timeline for d3dc7a1:
View in 3DDomains from other chains: (mouse over for more information) d3dc7b2, d3dc7b3, d3dc7c2, d3dc7c3 |