Lineage for d1em1b1 (1em1 B:1-83)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 276870Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 276989Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 276990Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 277069Protein Mn superoxide dismutase (MnSOD) [46618] (6 species)
  7. 277113Species Human (Homo sapiens) [TaxId:9606] [46619] (11 PDB entries)
  8. 277125Domain d1em1b1: 1em1 B:1-83 [15753]
    Other proteins in same PDB: d1em1a2, d1em1b2
    complexed with mw1, so4; mutant

Details for d1em1b1

PDB Entry: 1em1 (more details), 2.13 Å

PDB Description: x-ray crystal structure for human manganese superoxide dismutase, q143a

SCOP Domain Sequences for d1em1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1em1b1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOP Domain Coordinates for d1em1b1:

Click to download the PDB-style file with coordinates for d1em1b1.
(The format of our PDB-style files is described here.)

Timeline for d1em1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1em1b2