![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (11 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) ![]() |
![]() | Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins) |
![]() | Protein Mn superoxide dismutase (MnSOD) [46618] (6 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46619] (11 PDB entries) |
![]() | Domain d1em1b1: 1em1 B:1-83 [15753] Other proteins in same PDB: d1em1a2, d1em1b2 complexed with mw1, so4; mutant |
PDB Entry: 1em1 (more details), 2.13 Å
SCOP Domain Sequences for d1em1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1em1b1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)} khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial qpalkfnggghinhsifwtnlsp
Timeline for d1em1b1: