Lineage for d1em1a1 (1em1 A:1-83)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 811Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
  4. 895Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 896Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 947Protein Mn superoxide dismutase (MnSOD) [46618] (3 species)
  7. 965Species Human (Homo sapiens) [TaxId:9606] [46619] (7 PDB entries)
  8. 972Domain d1em1a1: 1em1 A:1-83 [15752]
    Other proteins in same PDB: d1em1a2, d1em1b2

Details for d1em1a1

PDB Entry: 1em1 (more details), 2.13 Å

PDB Description: x-ray crystal structure for human manganese superoxide dismutase, q143a

SCOP Domain Sequences for d1em1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1em1a1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOP Domain Coordinates for d1em1a1:

Click to download the PDB-style file with coordinates for d1em1a1.
(The format of our PDB-style files is described here.)

Timeline for d1em1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1em1a2