SCOPe 2.06: Domain d3dbyq2: 3dby Q:126-260

Lineage for d3dbyq2 (3dby Q:126-260)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.13: Bacillus cereus metalloprotein-like [158430] (1 family)
   Duplication: tandem repeat of two domains of this fold with similar sequences; binds a dimetal ion cluster between the repeats
   automatically mapped to Pfam PF11155

5. Family a.29.13.1: Bacillus cereus metalloprotein-like [158431] (2 proteins)

6. Protein Uncharacterized protein BCE_G9241_0798 [158434] (1 species)

7. Species Bacillus cereus [TaxId:1396] [158435] (1 PDB entry)
   Uniprot Q4MWP8 125-259! Uniprot Q4MWP8 4-124

8. Domain d3dbyq2: 3dby Q:126-260 [157519]
   Other proteins in same PDB: d3dbya3, d3dbyb3, d3dbyb4, d3dbyc3, d3dbyc4, d3dbyd3, d3dbye3, d3dbyf3, d3dbyf4, d3dbyg3, d3dbyh3, d3dbyh4, d3dbyi3, d3dbyj3, d3dbyk3, d3dbyl3, d3dbym3, d3dbyn3, d3dbyo3, d3dbyp3, d3dbyq3, d3dbyr3, d3dbys3, d3dbyt3, d3dbyt4
   automated match to d3dbya2
   complexed with edo, fe

Details for d3dbyq2

PDB Entry: 3dby, 2.1 Å

PDB Description: crystal structure of uncharacterized protein from bacillus cereus g9241 (csap target)

PDB Compounds: (Q:) Uncharacterized protein

SCOPe Domain Sequences for d3dbyq2:

Sequence; same for both SEQRES and ATOM records:

>d3dbyq2 a.29.13.1 (Q:126-260) Uncharacterized protein BCE_G9241_0798 {Bacillus cereus [TaxId: 1396]}
vfhelhyhlvwltdaaghagsisggldlvekrlkekseeftkhfeqfylkavemtgylrt
elhhfpalkkftkdvslelklfshflheveelelsnevlsvlsarmadhmareecyyllk
laqssglempkcnpl

Timeline for d3dbyq2:

• d3dbyq2 first appeared in SCOP 1.75
  
• d3dbyq2 appears in SCOPe 2.05
  
• d3dbyq2 appears in SCOPe 2.07
  
• d3dbyq2 appears in the current release, SCOPe 2.08