Lineage for d3dbyp2 (3dby P:126-260)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708948Superfamily a.29.13: Bacillus cereus metalloprotein-like [158430] (1 family) (S)
    Duplication: tandem repeat of two domains of this fold with similar sequences; binds a dimetal ion cluster between the repeats
    automatically mapped to Pfam PF11155
  5. 2708949Family a.29.13.1: Bacillus cereus metalloprotein-like [158431] (2 proteins)
  6. 2708950Protein Uncharacterized protein BCE_G9241_0798 [158434] (1 species)
  7. 2708951Species Bacillus cereus [TaxId:1396] [158435] (1 PDB entry)
    Uniprot Q4MWP8 125-259! Uniprot Q4MWP8 4-124
  8. 2708983Domain d3dbyp2: 3dby P:126-260 [157517]
    Other proteins in same PDB: d3dbya3, d3dbyb3, d3dbyb4, d3dbyc3, d3dbyc4, d3dbyd3, d3dbye3, d3dbyf3, d3dbyf4, d3dbyg3, d3dbyh3, d3dbyh4, d3dbyi3, d3dbyj3, d3dbyk3, d3dbyl3, d3dbym3, d3dbyn3, d3dbyo3, d3dbyp3, d3dbyq3, d3dbyr3, d3dbys3, d3dbyt3, d3dbyt4
    automated match to d3dbya2
    complexed with edo, fe

Details for d3dbyp2

PDB Entry: 3dby (more details), 2.1 Å

PDB Description: crystal structure of uncharacterized protein from bacillus cereus g9241 (csap target)
PDB Compounds: (P:) Uncharacterized protein

SCOPe Domain Sequences for d3dbyp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dbyp2 a.29.13.1 (P:126-260) Uncharacterized protein BCE_G9241_0798 {Bacillus cereus [TaxId: 1396]}
vfhelhyhlvwltdaaghagsisggldlvekrlkekseeftkhfeqfylkavemtgylrt
elhhfpalkkftkdvslelklfshflheveelelsnevlsvlsarmadhmareecyyllk
laqssglempkcnpl

SCOPe Domain Coordinates for d3dbyp2:

Click to download the PDB-style file with coordinates for d3dbyp2.
(The format of our PDB-style files is described here.)

Timeline for d3dbyp2:

View in 3D
Domains from other chains:
(mouse over for more information)
d3dbya1, d3dbya2, d3dbya3, d3dbyb1, d3dbyb2, d3dbyb3, d3dbyb4, d3dbyc1, d3dbyc2, d3dbyc3, d3dbyc4, d3dbyd1, d3dbyd2, d3dbyd3, d3dbye1, d3dbye2, d3dbye3, d3dbyf1, d3dbyf2, d3dbyf3, d3dbyf4, d3dbyg1, d3dbyg2, d3dbyg3, d3dbyh1, d3dbyh2, d3dbyh3, d3dbyh4, d3dbyi1, d3dbyi2, d3dbyi3, d3dbyj1, d3dbyj2, d3dbyj3, d3dbyk1, d3dbyk2, d3dbyk3, d3dbyl1, d3dbyl2, d3dbyl3, d3dbym1, d3dbym2, d3dbym3, d3dbyn1, d3dbyn2, d3dbyn3, d3dbyo1, d3dbyo2, d3dbyo3, d3dbyq1, d3dbyq2, d3dbyq3, d3dbyr1, d3dbyr2, d3dbyr3, d3dbys1, d3dbys2, d3dbys3, d3dbyt1, d3dbyt2, d3dbyt3, d3dbyt4