SCOPe 2.06: Domain d3dbyi1: 3dby I:5-125

Lineage for d3dbyi1 (3dby I:5-125)

Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds)
Fold a.29: Bromodomain-like [47363] (15 superfamilies)
4 helices; bundle; minor mirror variant of up-and-down topology

Superfamily a.29.13: Bacillus cereus metalloprotein-like [158430] (1 family)

Duplication: tandem repeat of two domains of this fold with similar sequences; binds a dimetal ion cluster between the repeats
automatically mapped to Pfam PF11155

Family a.29.13.1: Bacillus cereus metalloprotein-like [158431] (2 proteins)
Protein Uncharacterized protein BCE_G9241_0798 [158434] (1 species)
Species Bacillus cereus [TaxId:1396] [158435] (1 PDB entry)
Uniprot Q4MWP8 125-259! Uniprot Q4MWP8 4-124

Domain d3dbyi1: 3dby I:5-125 [157502]
Other proteins in same PDB: d3dbya3, d3dbyb3, d3dbyb4, d3dbyc3, d3dbyc4, d3dbyd3, d3dbye3, d3dbyf3, d3dbyf4, d3dbyg3, d3dbyh3, d3dbyh4, d3dbyi3, d3dbyj3, d3dbyk3, d3dbyl3, d3dbym3, d3dbyn3, d3dbyo3, d3dbyp3, d3dbyq3, d3dbyr3, d3dbys3, d3dbyt3, d3dbyt4
automated match to d3dbya1
complexed with edo, fe

Details for d3dbyi1

PDB Entry: 3dby (more details), 2.1 Å

PDB Description: crystal structure of uncharacterized protein from bacillus cereus g9241 (csap target)

PDB Compounds: (I:) Uncharacterized protein

SCOPe Domain Sequences for d3dbyi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dbyi1 a.29.13.1 (I:5-125) Uncharacterized protein BCE_G9241_0798 {Bacillus cereus [TaxId: 1396]}
nyeesalfehqfwlkvltdhaqflldalapkekedikkatyfvetftnllnkvrnvnlma
fskeaeqaakeirafklniiqkqlegkitihftptfinhmvneveeyiavleflkkgevp
p

SCOPe Domain Coordinates for d3dbyi1:

Click to download the PDB-style file with coordinates for d3dbyi1.
(The format of our PDB-style files is described here.)

Timeline for d3dbyi1: