Lineage for d3dbrc_ (3dbr C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149982Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest
  4. 2149983Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) (S)
    transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
    the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds
  5. 2149990Family c.111.1.2: Ubiquitin activating enzymes (UBA) [89763] (3 protein domains)
    the common fold is elaborated with additional (sub)domains
  6. 2149991Protein Amyloid beta precursor protein-binding protein 1, APPBP1 [89766] (1 species)
    a subunit of the heterodimeric E1 enzyme for NEDD8; contains a large insertion (residues 170-487) that can be divided into 3 units similar to the UBA3 insertion
  7. 2149992Species Human (Homo sapiens) [TaxId:9606] [89767] (10 PDB entries)
    Uniprot Q13564
  8. 2150015Domain d3dbrc_: 3dbr C: [157483]
    Other proteins in same PDB: d3dbrb1, d3dbrb2, d3dbrd1, d3dbrd2, d3dbrf1, d3dbrf2, d3dbrh1, d3dbrh2, d3dbri1, d3dbri2, d3dbrj1, d3dbrj2, d3dbrk1, d3dbrk2, d3dbrl1, d3dbrl2
    automated match to d1tt5a_
    complexed with zn

Details for d3dbrc_

PDB Entry: 3dbr (more details), 3.05 Å

PDB Description: structural dissection of a gating mechanism preventing misactivation of ubiquitin by nedd8's e1 (appbp1-uba3arg190gln-nedd8ala72arg)
PDB Compounds: (C:) NEDD8-activating enzyme E1 regulatory subunit

SCOPe Domain Sequences for d3dbrc_:

Sequence, based on SEQRES records: (download)

>d3dbrc_ c.111.1.2 (C:) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]}
kllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqv
sgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftv
vvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrl
dkpfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykekedfrd
lirqgilkpedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfwilara
lkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakllqsigq
apesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivlylmlr
avdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcrygaaep
htiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql

Sequence, based on observed residues (ATOM records): (download)

>d3dbrc_ c.111.1.2 (C:) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]}
kllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqv
sgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftv
vvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrl
dkpfpelrehfqsydhshtpwiviiakylaqwysetngripktykekedfrdlirqgilk
pedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfwilaralkefvake
gqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakllqsigqapesisek
elkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivlylmlravdrfhkq
qgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcrygaaephtiaaflg
gaaaqevikiitkqfvifnntyiysgmsqtsatfql

SCOPe Domain Coordinates for d3dbrc_:

Click to download the PDB-style file with coordinates for d3dbrc_.
(The format of our PDB-style files is described here.)

Timeline for d3dbrc_: